Unsplash logo
Avatar of user Getty Images
Unsplash+
In collaboration with Getty Images
A lockDownload
an aerial view of a busy highway in a city

an aerial view of a busy highway in a city

Download this HD photo of skyscraper, cityscape, river, and traffic by Getty Images (@gettyimages)

Calendar outlinedPublished on SafetyLicensed under the Unsplash+ License
skyscrapercityscaperivertrafficjapanese culturephotographydevelopmentHd water wallpapersHd city wallpapershorizontalarchitectureferris wheelaerial viewcolor imagecapital citiesjapantransportationdayno peoplecrowdedPublic domain images

From this series

Plus sign for Unsplash+
an aerial view of a city with lots of buildings

Related collections

Feet
41 images · Curated by Alison Costa
feetshoeleg
Water
173 images · Curated by Toni Pou
Hd water wallpapersHd wave wallpaperssea