Download free
book, marker pen, and eyeglasses on white surface
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Business & Work

book, marker pen, and eyeglasses on white surface

Download this free HD photo of create, book, marker, and bujo by Estée Janssens (@esteejanssens)

Calendar outlinedPublished on CameraCanon, PowerShot G7 X Mark II
SafetyFree to use under the Unsplash License
createBook images & photosmarkerbujoCreative imagesbullet journaldeskflatlayplanningmakeglassesplanplannerjournalBrown backgroundspendantornamentPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Home School
81 images · Curated by Susan (Lewis) Penix
homeschoolHd kids wallpapers
The Cozy Lotus
140 images · Curated by Jessica Hileman
gribrujaplantum
Planning
53 images · Curated by Kassandra Zimmerman
planningplannerdesk