Download free
green trees near white concrete building during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

green trees near white concrete building during daytime

skyscrapers in the city

A map markerMilano, Metropolitan City of Milan, Italy
Calendar outlinedPublished on CameraSONY, ILCE-6000
SafetyFree to use under the Unsplash License
Italy pictures & imagesmetropolitan city of milanmilanoHd city wallpapersbuildingurbanoffice buildingconstructionarchitectureskyscraperHd sky wallpapersbusinessbuildingsofficeHd blue wallpapersdowntownskylinetallcityscapereflectionPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

DBU
71 images · Curated by Franziska Erdle
dbuhumanHd grey wallpapers
Smart City
3 images · Curated by Andreas Michel
smartHd city wallpapersbuilding
ARCHVIZ
5 images · Curated by Alex Amat
archvizcasaedificio