Download free
woman in black shirt wearing silver necklace
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
1,000,000+ Free Images › Things Images › Eye Images

woman in black shirt wearing silver necklace

Download this free HD photo of portrait, closeup, serious, and woman by Dmitry Shamis (@dimashamis)

Calendar outlinedPublished on CameraSONY, ILCE-6000
SafetyFree to use under the Unsplash License
portraitcloseupseriousWomen images & picturesfacePeople images & pictureshumanheadHd grey wallpapersBrown backgroundsaccessoryaccessoriesjewelrynecklaceskinfemalehairphotographyphotoGirls photos & imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Realm
796 images · Curated by CJ Dunham
realmHq background imagesHd wallpapers
Faces
51 images · Curated by Bridie D
faceportraithuman