Download free
a long empty road with mountains in the background
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Nature

a long empty road with mountains in the background

Road trip through California

A map markerCalifornia, USA
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D3300
SafetyFree to use under the Unsplash License
usaCalifornia picturesHd grey wallpapersmountain roadSunset images & picturesroad triproadNature imagesasphalttarmacfreewayhighwayoutdoorsLandscape images & picturesHd scenery wallpaperslandHd sky wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Travel
14 images · Curated by Ira Shambary
Travel imagesHd wallpapersoutdoor
Sunsets and sunrises
91 images · Curated by Polina Kuzovkova
sunriseSunset images & picturesoutdoor
wallpapers
32 images · Curated by julia dunets
Hd wallpapersoutdoorHd grey wallpapers