Download free
body of water
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

body of water

Download this free HD photo of sea, ocean, wave, and foam by Victoria Kurtovich (@victoria_kurto)

Calendar outlinedPublished on CameraCanon, EOS 600D
SafetyFree to use under the Unsplash License
seaHd ocean wallpapersHd wave wallpapersfoamHd water wallpapersoutdoorsNature imageswafecrestwetspraysplashcoastBeach images & picturesHd grey wallpapersHd wave wallpapersrough seascrestsHd dark wallpaperssea wavesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Water
247 images · Curated by Abigail Naidu
Hd water wallpapersHd wave wallpapersoutdoor
Mannasites
66 images · Curated by Mallory MacDonald
mannasitebusinessPeople images & pictures
mario life saving
11 images · Curated by Zoop Kamm
sea wafeoutdoorsea