Download free
gray concrete pathway between green trees during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

gray concrete pathway between green trees during daytime

Download this free HD photo of grey, arbour, outdoors, and garden by MChe Lee (@mclee)

Calendar outlinedPublished on CameraCanon, EOS 5D
SafetyFree to use under the Unsplash License
Hd grey wallpapersarbouroutdoorsgardenpathslatewalkwayflagstonebuildingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

General for SM
39 images · Curated by Kate Riley
outdoorHd grey wallpapersplant
Green
31 images · Curated by Anton Pronkin
Hd green wallpapersplantLeaf backgrounds
fantasy
162 images · Curated by Solaris Kim
fantasyHd grey wallpapersplant