Download free
red and black tractor on brown grass field during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

red and black tractor on brown grass field during daytime

instagram - @jakobnoahrosen

Calendar outlinedPublished on CameraCanon, EOS 90D
SafetyFree to use under the Unsplash License
autonomyHd grey wallpapersNature imagesoutdoorscountrysideharvestfieldfarmtransportationvehiclemilitary uniformarmymilitarytankarmoredagricultureLandscape images & picturesgrasslandvegetableFood images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

out of city
11 images · Curated by jordan mathieu
Hd wallpapersoutdoorplant
Autonomy
10 images · Curated by Unsplash Plus
autonomyoutdoorwalking
Agriculture
18 images · Curated by ANDREAS GANATSIOS
agricultureoutdoorfield